Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

736 – 750 of 129,969 results

736

Invitrogen™ Bovine TNF-alpha Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	17.4 kDa
Formulation	PBS with no preservative
Sequence	Bovine TNF-alpha, amino acids 77-233 (Accession # Q06599)
For Use With (Application)	ELISA,Immunoprecipitation,Western Blot
Source	Yeast
Name	Bovine TNF-alpha
Recombinant	Recombinant

737

Invitrogen™ Mouse IL-10 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>98% by SDS-PAGE and HPLC
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	18.7 kDa
Formulation	protein with no preservative
Sequence	Mouse IL-10 recombinant protein contains 161 amino acids
For Use With (Application)	Control,ELISA,Immunoprecipitation,Western Blot
Source	E. Coli
Name	Mouse IL-10
Recombinant	Recombinant

738

Invitrogen™ Human FGFR1, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	50.4 kDa
Formulation	50 mM tris with 0.05% Triton X-100, 0.2 mM EDTA, 100 mM NaCl, 50% glycerol, 5 mM DTT and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human FGFR1, His Tag
Recombinant	Recombinant

739

Invitrogen™ Human FYN A, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	87.1 kDa
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human FYN A, GST Tag
Recombinant	Recombinant

740

Invitrogen™ Human BRAF, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	B-Raf
Molecular Weight (g/mol)	113.6 kDa
KinaseFamily	RAF Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human BRAF, GST Tag
Accession Number	P15056
Gene Alias	94 kDa B-raf protein; 9930012E13Rik; AA120551; AA387315; AA473386; Braf; B-raf; B-raf protein; B-raf protein isoform 1; B-raf protein isoform 2; B-Raf proto-oncogene serine/threonine-protein kinase; B-Raf proto-oncogene serine/threonine-protein kinase (p94); B-Raf proto-oncogene, serine/threonine kinase; Braf transforming gene; BRAF1; B-RAF1; Braf2; Braf-2; C230098H17; C87398; C-RMIL; D6Ertd631e; FLJ95109; MGC126806; murine sarcoma viral (v-raf) oncogene homolog B1; NS7; p94; Proto-oncogene B-Raf; proto-oncogene c-Rmil; RAFB1; RMIL; rmil serine/threonine-protein kinase; serine/threonine kinase; serine/threonine-protein kinase B-raf; Serine/threonine-protein kinase Rmil; v-raf murine sarcoma viral oncogene homolog B; v-raf murine sarcoma viral oncogene homolog B1
Gene ID (Entrez)	673
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

741

Invitrogen™ Human ACVR2A, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	ACVR2A
Molecular Weight (g/mol)	85.3 kDa
KinaseFamily	STKR Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human ACVR2A, GST Tag
Accession Number	P27037
Gene Alias	activin A receptor type 2 A; activin A receptor type IIA; activin A receptor, type IIA; activin receptor IIA; activin receptor type IIA; Activin receptor type-2 A; Actrii; ActrIIa; ACTR-IIA; ACVR2; Acvr2a; rActR-II; TactrII; type II activin receptor
Gene ID (Entrez)	92
Formulation	50 mM tris HCl with 0.02% NP-40, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

742

Invitrogen™ Human PIM1, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	40.7 kDa
Formulation	50 mM tris HCl with 0.05% Triton X-100, 0.5 mM EDTA, 2 mM DTT, 50% glycerol, 500 mM NaCl and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human PIM1, His Tag
Recombinant	Recombinant

743

Invitrogen™ Human LRRK2 [R1441C], GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	204.8 kDa
Formulation	50 mM tris with no preservative
Sequence	Catalytic domain [R1441C]
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human LRRK2 [R1441C], GST Tag
Recombinant	Recombinant

744

Invitrogen™ Human Tartrate Resistant Acid Phosphatase (aa 35-121) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	GGVPNAPFHTAREMANAKEIARTVQILGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQI
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human Tartrate Resistant Acid Phosphatase (aa 35-121) Control Fragment
Recombinant	Recombinant

745

Invitrogen™ Human NLK, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	NLK
Molecular Weight (g/mol)	84.5 kDa
KinaseFamily	MAP Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human NLK, GST Tag
Accession Number	Q9UBE8
Gene Alias	AI194375; LAK1; nemo like kinase; nemo-like kinase; NLK; Protein LAK1; RGD1561602; serine/threonine protein kinase NLK; serine/threonine-protein kinase NLK
Gene ID (Entrez)	51701
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

746

Invitrogen™ Human uPAR (aa 51-156) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human uPAR (aa 51-156) Control Fragment
Recombinant	Recombinant

747

Invitrogen™ Human FRAP1 (mTOR), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	163.9 kDa
Formulation	50 mM tris with 0.1% polysorbate 20, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human FRAP1 (mTOR), GST Tag
Recombinant	Recombinant

748

Invitrogen™ Human PAK1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	88.1 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human PAK1, GST Tag
Recombinant	Recombinant

749

Invitrogen™ Human CDK2/cyclin E1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	CDK2
Molecular Weight (g/mol)	60.2-73.4 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human CDK2/cyclin E1, GST Tag
Accession Number	P24941
Gene Alias	A630093N05Rik; CDC28; CDC2A; cdc2-related protein kinase; CDK1; CDK2; CDKN2; Cell division protein kinase 2; cyclin dependent kinase 2; cyclin dependent kinase 2-alpha; cyclin-dependent kinase 2; EC 2.7.11.22; EC 2.7.11.23; kinase Cdc2; MPF; p33 protein kinase; p33(CDK2); p33CDK2; p34 protein kinase
Protein Length	1-298
Gene ID (Entrez)	1017
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

750

Invitrogen™ Human FYN, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	Fyn
Molecular Weight (g/mol)	62.7 kDa
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human FYN, His Tag
Accession Number	P06241
Gene Alias	AI448320; AW552119; C syn protooncogene; c-syn protooncogene; EC 2.7.10.2; Fyn; fyn {ECO:0000312; FYN oncogene related to SRC, FGR, YES; Fyn proto-oncogene; FYN proto-oncogene, Src family tyrosine kinase; kinase Fyn; MGC45350; OKT3-induced calcium influx regulator; OTTHUMP00000017916; OTTHUMP00000017917; P59 p59-Fyn; p59-Fyn; Proto-oncogene c-Fyn; Protooncogene Syn; proto-oncogene Syn; proto-oncogene tyrosine-protein kinase Fyn; RGD:2641}; RP1-66H14.1; SLK; Src Kinase p59; Src like kinase; src/yes-related novel; src-like kinase; SYN; tyrosine kinase p59fyn(T); tyrosine-protein kinase Fyn
Product Type	FYN Recombinant Human Protein
Gene ID (Entrez)	2534
Formulation	20 mM tris with 0.05% NP-40, 0.05 mM EDTA, 100 mM NaCl, 1 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

Prev
1
...
48
49
50
51
...
8,665
Next

Recombinant Proteins

Filtered Search Results

Narrow Results